PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim03g115940.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 502aa    MW: 54503.8 Da    PI: 5.1704
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim03g115940.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.5e-39157217262
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  Sopim03g115940.0.1 157 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKSCQRYWTAGGTMRNVPVGAGRRKNKNSA 217
                         7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-30154214IPR003851Zinc finger, Dof-type
PfamPF027013.1E-32159215IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.919161215IPR003851Zinc finger, Dof-type
PROSITE patternPS013610163199IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 502 aa     Download sequence    Send to blast
MREVKEPEIK LFGKKIVLPE NGMILPVIVT GEDSDVGKSM SASEVVTADE SSTGSDRDPC  60
LVDKEGNSSQ QDESDDGSEY EKDEADKDRM TRELSEAKLE EKDQNLMMEE SENLKSPSEN  120
KTKTHTIDDD SPTVKSSKTE DDQNDASNSQ QKTLKKPDKI LPCPRCNSMD TKFCYYNNYN  180
VNQPRHFCKS CQRYWTAGGT MRNVPVGAGR RKNKNSASHC RHIMISEALE AARIDPPNGF  240
SHPVFKPNGT VLSFGPDLPL CDSMASVLNL AENKTPNGIR NGLYRPENPS GIGGENGDDC  300
SSGSSVTTSN SMAEGVKNCP PEAVMQTINA FPSPVPCLPG VPWPIPYAAV PFPAISPAGY  360
PMPFCPPPYW NCNVPGPWSL PWLTPPSPTA NQKGSVSAPN SPLGKHSRDG ELLKPNNPEG  420
QKNSEGSVLV PKTLRIDDPD EAAKSSIWST LGIKYDSVSR GGLFKSLQPK NSEKDHPTTT  480
SPSLQANPAA FSRSLSFQER V*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755150.0HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004235992.10.0PREDICTED: cyclic dof factor 1-like
TrEMBLK4BL960.0K4BL96_SOLLC; Uncharacterized protein
STRINGSolyc03g115940.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.12e-92cycling DOF factor 3